PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G349300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family HD-ZIP
Protein Properties Length: 751aa    MW: 82239.2 Da    PI: 8.572
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G349300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox52.77.1e-17112166256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         r+ +++t++qle+Le +F  + +p++++r++LA  +gL   qVk+WFqN+R++ k
  Sevir.5G349300.1.p 112 RSLHRLTSQQLEILEGFFSVCAHPDENQRRQLAIATGLALHQVKFWFQNKRTQVK 166
                         556789*********************************************9987 PP

2START90.43.7e-292694841206
                         HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S...EE CS
               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla...ka 79 
                         e+a++a+ el+ + ++++p+W+ ++    e +n++ ++q+f+ + +     +++ea ra +vv   +  lve l+d   ++ + +    + 
  Sevir.5G349300.1.p 269 EVANSATHELLILGDSDCPLWMAVPggsfEVLNKMAYTQTFPGQISvgaigFKTEATRANAVVMLGSKSLVEYLMDAE-RYGTFFLglmSG 358
                         57899999*********************************77777**************************999999.777777777745 PP

                         EEEEEECTT.........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
               START  80 etlevissg.........galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                         +t+ ++ +          ga ql + el+++splvp R+ +f+Ry+++l+ g  ++vdvS+d  +         ++++ pSgili+p+  +
  Sevir.5G349300.1.p 359 ATTTKVYNWpknseegyeGAMQLLTVELVFPSPLVPaRKCTFLRYCKRLEHGAIAVVDVSLDGGA---------KCRKMPSGILIQPMRHN 440
                         4444444434557999******************************************9998655.........599************** PP

                         EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          +kvt++ehv ++g + h+l+++ + sgl +ga++wv  + rqc++
  Sevir.5G349300.1.p 441 SCKVTVIEHVRVDGGT-HNLFQPSL-SGLLFGARRWVMSMARQCAR 484
                         **************97.69999988.79***************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-1799162IPR009057Homeodomain-like
SuperFamilySSF466898.77E-17103167IPR009057Homeodomain-like
SMARTSM003895.2E-15108172IPR001356Homeobox domain
PROSITE profilePS5007115.289108168IPR001356Homeobox domain
CDDcd000864.15E-14111167No hitNo description
PfamPF000461.6E-14112166IPR001356Homeobox domain
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
PROSITE profilePS5084821.516260487IPR002913START domain
CDDcd088752.03E-75265483No hitNo description
SuperFamilySSF559617.0E-18267485No hitNo description
SMARTSM002341.9E-12269484IPR002913START domain
PfamPF018522.8E-21269484IPR002913START domain
SuperFamilySSF559612.61E-6527706No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 751 aa     Download sequence    Send to blast
MRISGPSGGN PSLMRSTSGI TDPSLMGSIG GISDPSLMGP PSTSVGFSSK KNDEKNLSNH  60
SQELHAKNGH GESHGAGASR INEVDSSILI GNKKAREESL GGGRDGPQPK KRSLHRLTSQ  120
QLEILEGFFS VCAHPDENQR RQLAIATGLA LHQVKFWFQN KRTQVKHLSG REENYRLKVE  180
NEMLREENNR FKLAHSNALC PRCTTDPGQL QILKELERLK VHNQVLQQEL QIRINNETSM  240
RTSPTRLFHL ESSSENVFVV QDDVQALTEV ANSATHELLI LGDSDCPLWM AVPGGSFEVL  300
NKMAYTQTFP GQISVGAIGF KTEATRANAV VMLGSKSLVE YLMDAERYGT FFLGLMSGAT  360
TTKVYNWPKN SEEGYEGAMQ LLTVELVFPS PLVPARKCTF LRYCKRLEHG AIAVVDVSLD  420
GGAKCRKMPS GILIQPMRHN SCKVTVIEHV RVDGGTHNLF QPSLSGLLFG ARRWVMSMAR  480
QCARLRDVFH VTNCALNVTA RGRKAVMKLA DNLLADYTSS ISGLPVDAWS VQCGEGTEED  540
VRIVYRRNDD TSNTAVVCAS ATFLLELPMR RVFDLLKNNL LRIKWDVLVN GGCVKEEVRV  600
ANGVGSEDAV SILHVKHGSG TNKEIMMILQ NSCYDASGSF MVYSSLDKNV MEMITSPGGE  660
HAINNISLFP AGFSLVPLPD PANLGAPMGE AGRTMMTAGF QILMKLARGT GLCPRSVSSA  720
IKIMSEKIAT IKDTLLNSHP VFYKRFPSTN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660716.10.0PREDICTED: homeobox-leucine zipper protein TF1
SwissprotQ5ZAY00.0TF1_ORYSJ; Homeobox-leucine zipper protein TF1
TrEMBLK3XF210.0K3XF21_SETIT; Uncharacterized protein
STRINGSi000488m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104752833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.11e-119protodermal factor 2